PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011083674.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ZF-HD
Protein Properties Length: 255aa    MW: 27895.4 Da    PI: 9.336
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011083674.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.94.3e-3254109359
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                     ++ Y+eClkNhAas+Gg+++DGCgEfmps geegt +alkCaAC+CHRnFHR+e++ 
  XP_011083674.1  54 RISYRECLKNHAASIGGNVTDGCGEFMPS-GEEGTLEALKCAACNCHRNFHRKEHHG 109
                     679*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.5E-2955107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-2355115IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.7E-3057106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.96157106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.83E-19176250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-30185250IPR009057Homeodomain-like
TIGRFAMsTIGR015652.3E-30189245IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSSIPGEDKE MRMQAPSLGY NINSLENPIS APEKARTLDP NSGGSKSNKP TNLRISYREC  60
LKNHAASIGG NVTDGCGEFM PSGEEGTLEA LKCAACNCHR NFHRKEHHGE SAAAAAMVHP  120
LQLPAPLPSP SMSQHRATHW SSMVQPVKMA FGSGGGGGSA GTDSSSAQLN FNAFHSNAVA  180
PPPPQFVTKK RFRTKFTAEQ KEKMLEFAEK LGWRIPREDD TEVQRFCAEV GVKRQVFKVW  240
MHNNKSSSKK NPQEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A1e-271882471675ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.10.0PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9M9S01e-61ZHD4_ARATH; Zinc-finger homeodomain protein 4
SwissprotQ9ZPW79e-62ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A022RZP31e-105A0A022RZP3_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000095819e-87(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-61homeobox protein 31